The dual monochromator optics allow the widest range of applications to be utilized for bioresearch and drug discovery applications, all without the need to change. The SpectraMax® Plus 384 adds the ability to read cuvettes. The plate reader optics are. Reads 96-well microplates in 5 seconds; Reads 384-well microplates in 16 seconds, Monochromator, tunable 1. Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 과 같은 Parameter를 검사하여 평가할 수 있습니다. both cuvette-based and microplate reader applications on the same instrument. Handles plates with up to 384 wells. 5 pM 384-well (50 µL) 6 pM 10 pM 1536-well (8 µL) 19 pM 25 pM 0200-7015 (LUM 384) Optimized Guaranteed* 96-well (200 µL) 1. Three low volume 24-well bottom slides. Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Table 2 summarizes the results for the uniformity test. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. Detection of species collected on membrane plates is also possible. 4 µL DNA standards. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. 304 signal level saturation. 0200-6263. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. More Product Information. SpectraMax ® Plus 384 optics. Community forums for Molecular Devices - SpectraMax Plus. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 384 wells < 45 sec. Browse for different fluorescent readers below and compare across different instrument suppliers. Beer-Lambert Law states that. For more sample throughput, the system canMicroplate Spectrophotometers. SpectraDrop High-Throughput Screening (HTS) Kit. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. These instruments measure the optical density (OD) of samples at selected wavelengths in a single read mode. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. Regularly used for NADPH ATPase assays, and BCA assays. Fluorescence Microplate Reader Comparison Chart. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. ester flash assays, in both 96- and 384-well plates. SoftMax® Pro Software for Windows 10 and 11 is designed to provide the simplicity, flexibility and power required for advanced data analysis. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. PathCheck sensor corrects optical pathlength & pipetting variation. Accessories and spare parts for microplate dispensers, Multidrop 384 and DW. Clearance . Our microplate readers and software are the industry’s most cited and have empowered life science researchers to advance protein and cell biology. QuickSync. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Open the catalog to page 2. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Clearance . The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. Instrument Description and Capabilities: Fluorescence. The PathCheck Sensor is a temperature independent feature from Molecular Devices that measures the optical pathlength of samples in microplate wells. The LMax plate reader has similar calculations and its RLUs are comparable to those of LMax II 384. , FI 45 sec. It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. , FI 15 sec. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. Flexible Template Assignment (Figure 1) to customize assays exactly to user specifications. 020 fmol 0. For more information, please visit us at Devices – Spectramax Gemini XS plate reader (Fluorescence) Molecular Devices – Spectramax 384 plus plate reader (UV/VIS) Invitrogen by Life technologies Qubit 2. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Thermo LTQ Orbitrap Velos LC/MS System. High sample correlation coefficients (R 2) make it easy to. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. Features. Customize data collection and analysis. SPECTRAmax PLUS 384 measuring instruments pdf manual download. dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. Fluorescence filters included in 1nm range. Service Contracts, Preventative Maintenance and Performance. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. For the reference reading, use the “0” standard. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. 303 unable to cal dark current. 2. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-Mode Molecular Devices SpectraMax Plus 384. The SpectraMax® M Series Multi-Mode Microplate Readers measure UV and visible absorbance, fluorescence, luminescence, fluorescence polarization, TRF and HTRF. The optical performance is comparable to a top-of-the-line dedicatedUnparalleled performance on a personalized platform. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. The optical performance is comparable to a top-of-the-line dedicatedThe SpectraMax 190 reader is the tool for DNA analysis. Cross-talk < 0. Description Control Panel Cuvette Chamber Back Panel Microplate Drawer The Control Panel TEMP on/off TEMP Figure 1. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. Stand alone mode is not available for the VersaMax. Cell viability는 세포막 Integrity 또는. In this product video, see how the SpectraMax M5 quickly reads samples. With optimized reagents, option to operate the. 100 fmol 1536-well (8 µL) 0. microplates or in a cuvette at a. SpectraMax® Plus 384 provides ultrafast, full spectral range. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. Customize data collection and analysis. Published Dec 16, 2020 | Updated Dec 16, 2020. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 0nm incrementsThe SPECTRAmax™ plus 384 microplate spectrophotometer provides rapid UV/VIS measurements of a variety of analytes. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. Supplier: Molecular Devices. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. VersaMaxreads96-wellplates. For more sample throughput, both readers can be easily integrated into full roboticMode 96-Well 384-Well 1536-Well Optimizedforspeed 20 seconds 33 seconds 68 seconds Optimizedforperformance 28 seconds 45 seconds 96 seconds Stop-and-go(off) 41 seconds 2 minutes <5 minutes. Data can be analyzed and combined from different plates. Detection modalities are shown in Table 1-1. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, SpectraMax Plus 384 reader, SpectraMax 190 reader, VersaMax reader, FlexStation 3 reader I need to reinstall the USB driver for my plate reader. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. Sold as-is. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. Next generation SpectraMax® absorbance microplate readers. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Set up SoftMax Pro Software to use PathCheck as detailed above. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. 8 in. . Top or bottom detection is available at the touch of a button. together with SpectraMax, VersaMax, VMax, and EMax microplate readers from Molecular Devices, offer a quality assurance screening solution for the detection of melamine contamination in such food products as milk, infant formula, pet food, and confectionery. Detection modalities are shown in Table 1-1. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. If desired, the samples can be transferred into cuvettes before reading. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2e. The SpectraMax 340PC384 system has a monochromator instead of interference filters. The low profile increases robotic stack capacity and storage. On the front panel of the instrument, press the load/eject button to move the microplate drawer outside of the instrument. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. Cables. Products : General, Microplate Readers. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. The SpectraMax® Gemini™ XPS Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. 100 fmol 384-well (75 µL) 0. 9. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. Light Source: Xenon flash lamp. Multimode Reader Comparison Chart. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Also refer to this Multimode Reader Comparison Chart. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. Reference diodes enable elimination of measurement noise due to slight fluctuations in. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 0 nm increments. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Made from polypropylene with conical well profiles to maximize recovery and allow working with sample volumes as low as 5 µl. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 3) This warranty covers the SPECTRAmax PLUS 384The SpectraMax 384 Plus UV/Vis Microplate Reader is manufactured by Molecular Devices. SpectraMax M series, Gemini, and SpectraMax iDx readers have xenon flash lamps,. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. 314 low lamp level warning. AlphaScreen assays cannot be done on the SpectraMax M series, Gemini, and SpectraMax iDx (iD3/iD5) readers. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Table 2. 4. com. The value for 1000 should be higher than the value for 900. The minimum order for this item is . Reliable performance with a proven track record. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with. 96- or 384-well microplate compatibility. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. The SpectraMax® ABS Plus Microplate Reader can run . These upright laboratory refrigerators will fulfill all general-purpose applications, with adequate space for ventilation. 1. Glad to help you. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. ELISAs/EIAs. SpectraMax® i3 Multi-ModeDetectionPlatform withtheSpectraMax® MiniMax™ImagingCytometer UserGuide 5025027A April2013. 306 plate air cal. Note: In this user guide, all references to SpectraMax Multi-Mode. The SpectraMax Paradigm Multi-Mode Detection. . to View. By using PathCheck, SpectraMax readers can automatically normalize sample absorbance values to a 1-cm pathlength and calculate the concentrations. SpectraMaxi3xMulti-ModeDetectionPlatformUserGuide 26 5039228DOther things to consider include plate format – 96-well and 384-well plates are the norm but higher and lower capacity plate sizes are also available, speed and throughput needed, type of software, and whether or not multiple plates or wells can be read simultaneously. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. reader in the visible range between 405–750 nm with NIST and NMI. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. Each sample has a discrete sample beam and reference beam. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Cross-talk < 0. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. Molecular Devices SpectraMax 340PC Microplate Spectrophotometer. Temperature control. 316 grating motor driver faulty. We would like to show you a description here but the site won’t allow us. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. used. Detection of species collected on membrane plates is also. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. Temperature control and shaking included as standard. Future ready The SpectraMax® i3x Multi-Mode microplate reader measures spectral-based Absorbance, Fluorescence, and Luminescence with the added functionality of modular. FilterMax F3 and F5 Multi-Mode; SpectraMax Paradigm® Multi-Mode. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. SpectraMax i3x Multi-Mode Microplate Reader. used. Choose cables that meet the requirement described in this appendix. This white, polystyrene ProxiPlate™ has shallow wells allowing for lower volumes to be used in assays. Get the best deals for spectramax plus 384 at eBay. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. Contact Us Phone: +1-800-635-5577 Web: Email: [email protected] are some cuvettes that have been tested in the M5 and Plus 384. SpectraMax i3x Injector Cartridge with SmartInject® Technology. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. Features. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurement in the visible range. It measures the optical density (OD) of samples in both 96- and 384-well. There were 12 replicate wells per dilution in both 96-well and 384- well plates. Expanded dynamic range Engineered for performance with spectral fusion illumination for increased sensitivity across the entire excitation range. Wavelength Selection: Monochromator, tunable 1. Wavelength optimization. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. SpectraMax340PC384reads96-wellplatesand384-wellplates. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. SpectraMax M2e Plate Reader; Application: Absorbance Concentration of Nucleic Acid: Fluorescence Concentration of RNA or DNA: Absorbance, Florescence, Luminescence RNA, DNA, Proteins: Range: 10ng-3000 ng (Accuracy diminishes less than 20 ng/µl and above 1500 ng/µl) RNA Broad Range: 20-1000 ng RNA: 5-100 ng DNA Broad Range: 2. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. Optimal volumes are usually stated as 'working volume', which is 25 - 90 mL. No accessories are needed and SoftMax® Pro Software. SpectraMax i3x Multi-Mode Microplate Reader. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Molecular Devices, LLC. Light Source: Xenon flash. It may be named "Pothos". 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. no. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. Molecular Devices. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Abs 49 sec. 6 (H) x 22. Monochromator wavelength selection saves you the time and trouble of ever having to. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. Detection modalities are shown in Table 1-1. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. You can use 6, 12, 24, 48, 96, and 384-well plates that conform to ANSI/SBS standard microplate footprint and dimensions in the instrument. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. SoftMax® Pro Software is included and enables data visualized in 3D plots, gray scale, kinetic curve. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. The microplates were read the next day from the bottom and the top in SpectraMax M5 and Gemini EM readers. 306 plate air cal fail,low light. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. Expanded wavelength coverage. 5014038F 3 Contents SafetyInformation 5 Warnings,Cautions,Notes,andTips 5 Chapter1:Introduction 11 ComputerIntegration 11 Applications 12 DualPhotomultiplierTubes 12For SpectraMax iD5, i3x, and Mini readers, the read height setting should be optimized for the microplate used. Item SpectraMax Plus 384 Microplate Spectrophotometer; Company Molecular Devices LLC; Catalog Number SpectraMax Plus 384; This product is no longer available on Biocompare. Tailored to your different needs, these kits are configured and optimized for Molecular Devices SpectraMax® microplate readers with preconfigured protocols provid- The SpectraMax® iD3 Multi Mode Microplate . Tb donor/red acceptor. Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. Multimode Reader Comparison Chart. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. Service parts for these models are not being produced and are no longer in stock. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. 384 wells: Abs 49 sec. This user guide provides detailed instructions, troubleshooting tips and technical specifications for these instruments. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. Results were presented as mean ± standard deviation. Detection modalities are shown in Table 1-1. Published Dec 16, 2020 | Updated May 19, 2023. SpectraMax340PC384reads96-wellplatesand384-wellplates. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. For valuable samples and higher-throughput requirements, the assays can be performed in 384-well microplates. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. Model is Spectramax Plus 384. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. 0 nm increments. SpectraMax Plus 384 reads 96-well plates, 384-well plates, and cuvettes. o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. Temperature control. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. 1: SpectraMax Plus 384 components. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 96 / 384 Head: Fixed Pin Tool - 384 Head: Grippable Pin Tool - 96 / 384 Head: Magnetic Pin Tool - 96 / 384 / 1536 Head: LUMINESCENCE MICROPLATE. Analyst, M5, Flex 3, and SpectraMax L readers work differently. 3) This warranty covers the SPECTRAmax PLUS 384384-well clear-bottom, scintillating microplate for cell-based radiometric proximity assays. Lids for a case of 200 microplates must be purchased separately. Sold as-is. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. spr SpectraMax Plus 384. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Chapter 1: General Information. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. For the SpectraMax Plus 384 you can do fixed point cuvette reads. It provides ready-to-run protocols, analysis algorithms, and 21 different curve fit options. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. craig@californialightworks. Product Specs; Item SpectraMax Plus 384 Spectrophotometer; Company Molecular Devices LLC; This product is no longer available on Biocompare. PathCheck Sensor. 96-, 384-, and 1536-well plates (depending on. 304 signal level saturation. 384 wells) and the "Select Specific" menu to choose the specific plate type. ®Supplier: Molecular Devices. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Details. spectramax id3 multi-mode microplate reader, spectramax id3, softmax pro 7 software, spectramax id3 injector system. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Microplate Spectrophotometer. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. 세포신호전달은 세포가 환경에 반응하고 다른 세포와 소통할 수 있게 합니다…. Molecular Devices SpectraMax 384 Plus Microplate Reader. SpectraMax Plus 384 Spectrophotometer from Molecular Devices LLC. . spectraMax 340pc 384 Microplate reader. Also for: Spectramax plus. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 5 pM 2. 384-well: Abs 49 sec. SpectraMax Gemini XPS/EM Register or Sign In. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Also refer to this Multimode Reader Comparison Chart. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. For more sample throughput, the system can be. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. Capture flash assays with ease Expand your lab’s capabilities to include flash applications such as dual luciferase and ATP assays with the SpectraMax iD3 injector system with SmartInject™ Technology ensuring equal mixingThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Hybrid optical system on the SpectraMax iD5 reader. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Molecular Devices Spectramax. Wavelength Selection: Monochromator, tunable 1. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Detection modalities are shown in Table 1-1. spr SpectraMax iD5 SpectraTest ABS2 v1. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. SpectraMax ® Plus 384 optics. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. Multimode Readers Comparison Chart. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v2. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 313 reference gain check fail. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Model: SpectraMax PLUS 384. Manufacturer: Molecular Devices Model: SpectraMax Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. 5 cm x. 2 SpectraMax MiniMax300ImagingCytometer(cytometer) 3.